Loading...
Statistics
Advertisement

Yablokosport.ru

Advertisement
Conversion Technology Metas Server
Yablokosport.ru is hosted in Russian Federation . Yablokosport.ru uses HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Html5, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: nginx/1.9.12.

Technologies in use by Yablokosport.ru

Technology

Number of occurences: 5
  • CSS
  • Html
  • Html5
  • Javascript
  • Yandex.Metrika

Advertisement

Server Type

  • nginx/1.9.12

CDN

Number of occurences: 1
  • CloudFlare

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Yablokosport.ru

SSL certificate

    • name: /C=RU/ST=SPb/L=SPb/O=Test Self SSL Company/OU=Test/CN=test-self-signed.spaceweb.ru/emailAddress=support@sweb.ru
    • subject:
      • C: RU
      • ST: SPb
      • L: SPb
      • O: Test Self SSL Company
      • OU: Test
      • CN: test-self-signed.spaceweb.ru
      • emailAddress: support@sweb.ru
    • hash: bb3679c5
    • issuer:
      • C: RU
      • ST: SPb
      • L: SPb
      • O: Test Self SSL Company
      • OU: Test
      • CN: test-self-signed.spaceweb.ru
      • emailAddress: support@sweb.ru
    • version: 0
    • serialNumber: 14722179982251353931
    • validFrom: 160525100943Z
    • validTo: 160524100943Z
    • validFrom_time_t: 1464170983
    • validTo_time_t: 1464084583
    • extensions:

    Meta - Yablokosport.ru

    Number of occurences: 3
    • Name:
      Content:
    • Name: keywords
      Content:
    • Name: description
      Content:

    Server / Hosting

    • IP: 77.222.40.59
    • Latitude: 55.74
    • Longitude: 37.61
    • Country: Russian Federation

    Rname

    • ns3.spaceweb.pro
    • ns1.spaceweb.ru
    • ns4.spaceweb.pro
    • ns2.spaceweb.ru
    • mx2.spaceweb.ru
    • mx1.spaceweb.ru

    Target

    • dns1.sweb.ru

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx/1.9.12 Date: Wed, 21 Sep 2016 11:39:48 GMT Content-Type: text/html Content-Length: 1690 Vary: Accept-Encoding Last-Modified: Sat, 02 Jul 2016 17:18:18 GMT ETag: "55419b-69a-536aa4a090a80" Accept-Ranges: bytes X-Cache: MISS from s_wx1113 Via: 1.1 s_wx1113 (squid/3.5.20) Connection: keep-alive

    DNS

    host: yablokosport.ru
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 77.222.40.59
    host: yablokosport.ru
    1. class: IN
    2. ttl: 600
    3. type: NS
    4. target: ns3.spaceweb.pro
    host: yablokosport.ru
    1. class: IN
    2. ttl: 600
    3. type: NS
    4. target: ns1.spaceweb.ru
    host: yablokosport.ru
    1. class: IN
    2. ttl: 600
    3. type: NS
    4. target: ns4.spaceweb.pro
    host: yablokosport.ru
    1. class: IN
    2. ttl: 600
    3. type: NS
    4. target: ns2.spaceweb.ru
    host: yablokosport.ru
    1. class: IN
    2. ttl: 600
    3. type: SOA
    4. mname: ns1.spaceweb.ru
    5. rname: dns1.sweb.ru
    6. serial: 2016070214
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 600
    host: yablokosport.ru
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 20
    5. target: mx2.spaceweb.ru
    host: yablokosport.ru
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 10
    5. target: mx1.spaceweb.ru

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ablokosport.ru, www.yzablokosport.ru, www.zablokosport.ru, www.yaablokosport.ru, www.aablokosport.ru, www.ysablokosport.ru, www.sablokosport.ru, www.ydablokosport.ru, www.dablokosport.ru, www.yablokosport.ru, www.ablokosport.ru, www.ycablokosport.ru, www.cablokosport.ru, www.y ablokosport.ru, www. ablokosport.ru, www.yblokosport.ru, www.yaoblokosport.ru, www.yoblokosport.ru, www.yapblokosport.ru, www.ypblokosport.ru, www.ya9blokosport.ru, www.y9blokosport.ru, www.yablokosport.ru, www.yblokosport.ru, www.yaiblokosport.ru, www.yiblokosport.ru, www.yaublokosport.ru, www.yublokosport.ru, www.yalokosport.ru, www.yabqlokosport.ru, www.yaqlokosport.ru, www.yabwlokosport.ru, www.yawlokosport.ru, www.yabzlokosport.ru, www.yazlokosport.ru, www.yabxlokosport.ru, www.yaxlokosport.ru, www.yablokosport.ru, www.yalokosport.ru, www.yabslokosport.ru, www.yaslokosport.ru, www.yabylokosport.ru, www.yaylokosport.ru, www.yabelokosport.ru, www.yaelokosport.ru, www.yabdlokosport.ru, www.yadlokosport.ru, www.yabclokosport.ru, www.yaclokosport.ru, www.yabokosport.ru, www.yabluokosport.ru, www.yabuokosport.ru, www.yabl8okosport.ru, www.yab8okosport.ru, www.yabl9okosport.ru, www.yab9okosport.ru, www.yabljokosport.ru, www.yabjokosport.ru, www.yabl0okosport.ru, www.yab0okosport.ru, www.yablmokosport.ru, www.yabmokosport.ru, www.yablpokosport.ru, www.yabpokosport.ru, www.yablookosport.ru, www.yabookosport.ru, www.yablkosport.ru, www.yablobkosport.ru, www.yablbkosport.ru, www.yablohkosport.ru, www.yablhkosport.ru, www.yablogkosport.ru, www.yablgkosport.ru, www.yablojkosport.ru, www.yabljkosport.ru, www.yablomkosport.ru, www.yablmkosport.ru, www.yablo kosport.ru, www.yabl kosport.ru, www.yablovkosport.ru, www.yablvkosport.ru, www.yabloosport.ru, www.yabloktosport.ru, www.yablotosport.ru, www.yablokosport.ru, www.yabloosport.ru, www.yablokgosport.ru, www.yablogosport.ru, www.yablokbosport.ru, www.yablobosport.ru, www.yabloknosport.ru, www.yablonosport.ru, www.yablokhosport.ru, www.yablohosport.ru, www.yablokyosport.ru, www.yabloyosport.ru, www.yabloklosport.ru, www.yablolosport.ru, www.yablokoosport.ru, www.yablooosport.ru, www.yablokuosport.ru, www.yablouosport.ru, www.yablokiosport.ru, www.yabloiosport.ru, www.yablokmosport.ru, www.yablomosport.ru, www.yabloksport.ru, www.yablokobsport.ru, www.yablokbsport.ru, www.yablokohsport.ru, www.yablokhsport.ru, www.yablokogsport.ru, www.yablokgsport.ru, www.yablokojsport.ru, www.yablokjsport.ru, www.yablokomsport.ru, www.yablokmsport.ru, www.yabloko sport.ru, www.yablok sport.ru, www.yablokovsport.ru, www.yablokvsport.ru, www.yablokoport.ru, www.yablokoseport.ru, www.yablokoeport.ru, www.yablokoswport.ru, www.yablokowport.ru, www.yablokosdport.ru, www.yablokodport.ru, www.yablokosxport.ru, www.yablokoxport.ru, www.yablokosfport.ru, www.yablokofport.ru, www.yablokosgport.ru, www.yablokogport.ru, www.yablokostport.ru, www.yablokotport.ru, www.yablokosort.ru, www.yablokospiort.ru, www.yablokosiort.ru, www.yablokospkort.ru, www.yablokoskort.ru, www.yablokospuort.ru, www.yablokosuort.ru, www.yablokospjort.ru, www.yablokosjort.ru, www.yablokosplort.ru, www.yablokoslort.ru, www.yablokosprt.ru, www.yablokospobrt.ru, www.yablokospbrt.ru, www.yablokospohrt.ru, www.yablokosphrt.ru, www.yablokospogrt.ru, www.yablokospgrt.ru, www.yablokospojrt.ru, www.yablokospjrt.ru, www.yablokospomrt.ru, www.yablokospmrt.ru, www.yablokospo rt.ru, www.yablokosp rt.ru, www.yablokospovrt.ru, www.yablokospvrt.ru,

    Other websites we recently analyzed

    1. Roma Hotel
      RomaHotel.it - Guida turistica e Hotel di Roma. Oltre 1100 Hotel a Roma che puoi prenotare online. Servizio di assistenza e prenotazione Hotel a Roma: inoltre Mappa della Città di Roma, Cosa Vedere, Itinerari, Musei e Attrazioni Turistiche di Roma
      Arezzo (Italy) - 46.37.17.210
      Server software: Apache/2.2.15 (CentOS)
      Technology: Google Adsense, AJAX Libraries API, CSS, Html, Javascript, Php, Google +1 Button
      Number of Javascript: 6
      Number of meta tags: 4
    2. 35789.kim
      China - 124.16.31.156
      Server software: Tengine/1.4.2
      Technology: CloudFront, Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    3. calvarychapelmerrimackvalley.com at Directnic
      Cayman Islands - 74.117.222.18
      Server software: nginx/1.5.0
      Technology: Html, Javascript
      Number of Javascript: 1
    4. Massachusetts Society of Mayflower Descendants - HOME
      The Mission of the Massachusetts Society of Mayflower Descendants is to gather together to honor and perpetuate the memory of our Mayflower Ancestors and the ideals of American freedoms and democracy, which have evolved from The Mayflower Compact signed by the Pilgrim Fathers when they reached Cape Cod shores in November, 1620.
      Provo (United States) - 67.20.65.25
      Server software: nginx/1.10.1
      Technology: PayPal, CSS, Html, Javascript, Php, Joomla, Add This
      Number of Javascript: 15
      Number of meta tags: 5
    5. 55517.date - Diese Website steht zum Verkauf! - Informationen zum Thema 55517.
      Diese Website steht zum Verkauf! 55517.date ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf 55517.date alles. Wir hoffen, dass Sie hier das Gesuchte finden!
      Cambridge (United States) - 72.52.4.90
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 5
    6. thebeautylotion.com
      Scottsdale (United States) - 50.63.202.48
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    7. giftgiffy.com
      Scottsdale (United States) - 184.168.221.62
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    8. seopill.com - Diese Website steht zum Verkauf! - Informationen zum Thema seopill.
      Diese
      Cambridge (United States) - 72.52.4.119
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 3
      Number of meta tags: 5
    9. tbmall.biz
      Osaka (Japan) - 219.94.155.247
      Server software: Apache/2.2.31
      Technology: Html
      Number of meta tags: 1
    10. Free business profile for GSMARKETING.US provided by Network Solutions
      Learn about GSMARKETING.US from this free business profile provided by Network Solutions
      Jacksonville (United States) - 205.178.189.129
      Server software: Sun-ONE-Web-Server/6.1
      Technology: CSS, Html, Php
      Number of meta tags: 3

    Check Other Websites